DPCstruct | MC61480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 11.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0023- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7ZPW0 | 18-142 | YENYGTLFKLIGEIPHNSCLILNSWEPPSDILTFTDDNLAVCLLQLTGLGEAATEIIREKGLLDEDRWPELINLYQGNPLWLKLVAQ… |
| A0A846G7U4 | 85-216 | IFSSGKLASHYSPEHKNYSQFFQFIAQLSHQSSCLTISREKLREISTAKNTSIRSLHLKGLDEEATKKILKDQDLQLDEQWQKLIDF… |
| A0A2T1DKG9 | 381-523 | None |
| A0A844MB21 | 197-342 | None |
| A0A1T4ZJ56 | 1-135 | None |
| A0A350XMR6 | 196-331 | None |
| A0A2W1JNW8 | 221-352 | None |
| A0A2K8T334 | 25-147 | None |
| A0A2Z6CFD5 | 2-115 | None |
| A0A1C0VXN9 | 81-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.