DPCstruct | MC6148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 14.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VZX3 | 87-213 | MCGRLTFCYWVVAAVPFYLATWEHYFTNTLILPVINGPTEGLMLIYVAHLFTFFTGAEWWAQDFRKSLPLISLVPLPFVPEIPLYVI… |
| A0A453R1P2 | 1-149 | MCGRLTFCYWVVAAVPFYLATWEHYFTNTLILPVINGPTEGLMLIYVSHLFTFFTGAEWWAQDFRKSLPLISLVPLPFVPEIPLYVI… |
| A0A0S6XNI5 | 2-159 | None |
| A0A287VZW9 | 84-231 | None |
| A0A2P5WUQ5 | 8-147 | None |
| A0A453N1J4 | 1-143 | None |
| A0A0G2ERK6 | 290-450 | None |
| A0A0G4MIX3 | 658-818 | None |
| A0A2H5SSQ9 | 104-230 | None |
| A0A0E0JUS3 | 103-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.