DPCstruct | MC61472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 124 ± 26 aa |
| Standard deviation of domain lengths | 26.24 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09809 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2YK02 | 9-158 | RSISTTAANFGKRNFRKFQLFNKRGSRNFKKQQMENPDSDVPIHTRGVKPVGYTENGQFITIPEKIPEIIVPDLTGFTLKPYVSYRT… |
| G7NET1 | 5-109 | TSKRGPRSFRGRKGRGAKGIGFLTSGCRFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPEGEETPLTAAQLFSEAVAPLIVQDFKDGT… |
| A0A0M4EVA5 | 1-97 | None |
| A0A183TDC8 | 1-93 | None |
| A0A820EQS7 | 9-84 | None |
| A0A5N5TF21 | 207-314 | None |
| A0A4C1UPK6 | 4-126 | None |
| A0A813PZS2 | 26-186 | None |
| A0A6P4YNP4 | 13-106 | None |
| A0A182VW77 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.