DPCstruct | MC61471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 194 ± 22 aa |
| Standard deviation of domain lengths | 21.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2YJ21 | 25-214 | QQRIELEEETCSELKQVFASLQQQVDFKRDKLKRINNKLQSIRQEIKDNHEVYLKDRQEIENANDEATVNLRQAFLIIDNFVPSEER… |
| A0A7S1L0C4 | 114-316 | EELKRQQRKLRKQHEREALLKEREEQQKQENEELESKCHSQEEQVAKLTTKLQKLWDKYQKAQQEMVDVQQFNQGEREEMLEMIREL… |
| A0A6G0YN77 | 542-734 | None |
| W2SK47 | 482-659 | None |
| A0A803XWA1 | 266-423 | None |
| A0A7S3T343 | 10-222 | None |
| A0A830H9P5 | 173-348 | None |
| A0A2T7PIF4 | 734-935 | None |
| A0A060YIF3 | 2-173 | None |
| A0A183EH26 | 13-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.