DPCstruct | MC61470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1960 |
|---|---|
| Mean domain length (aa) | 123 ± 27 aa |
| Standard deviation of domain lengths | 26.90 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 68.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.86 |
| Pfam Score | 96.58 |
| Assigned Pfam label(s) | PF02183- PF12045- CL0123- PF12407- CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EKR8 | 1-60 | RRKRTAFTHAQLQFLEKKFNCQKYLSVAERADVADGLNLTETQIKTWYQNRRTKWKRQTT |
| A0A6J2Y8Z7 | 6-127 | TSQSQSVSTVQPNYHSLRLHPFGNLPTVSAYPPAVATRKQRRNRTTYSKEQLKLLEILFEKNRYPDIFMREEVAAKIRVAESRVQVW… |
| A0A6P4ENP8 | 50-172 | None |
| A0A0C2MDK8 | 90-264 | None |
| A0A6P5GDV6 | 70-216 | None |
| A0A6P4E9V6 | 332-446 | None |
| A0A1V2LK11 | 212-317 | None |
| A0A669CZR1 | 51-189 | None |
| A0A654HBM1 | 133-248 | None |
| A0A1B0C357 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.