DPCstruct | MC6147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 112 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5WWT1 | 102-213 | LGKLHVGYSWLDFPEFNLSVVGARPFSWGSSKWKKENFYRDRYQINSFAESTQRITESVSNTKHDTVIFLGHNGPSGLGKEEYSICG… |
| A0A453QY17 | 1-123 | MRPMIPFFLVNISLGEQHAGYQCLDFPTIKLSVVGGRPFSCGGDRLFRPKLLSQRYGVDDMSGSVRKIYDAATAAPEEHSVILLAHN… |
| A0A6V7PAA2 | 133-230 | None |
| A0A287VW92 | 79-191 | None |
| A0A287VW72 | 78-190 | None |
| A0A0H5PQY4 | 12-119 | None |
| A0A803LQH1 | 5-129 | None |
| B9FRV1 | 88-200 | None |
| A0A0K9QRP3 | 568-680 | None |
| M4DV38 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.