DPCstruct | MC61461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 193 ± 30 aa |
| Standard deviation of domain lengths | 30.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2AVV9 | 9-217 | ETLAADGLRAIAAGKIDDGGADSVSDAVEAQNDVPPPLPQDAPAEQVRTWWESLTGDQQQYMMDNEPDAIRNLWGLPSVVRDELNRE… |
| A0A4R0HMN7 | 5-190 | LDALILRVRDLPHDRAVGEVDAFFTALPSEVATALAESRPEQVGPLEGAPPELRYRANRLILESAQQRLHALVESRDATLAQRRRLL… |
| X8FMF9 | 49-276 | None |
| A0A430JVT9 | 10-147 | None |
| A0A3S0C3A2 | 155-369 | None |
| A0A1A3N503 | 84-258 | None |
| A0A124E947 | 263-452 | None |
| A0A251XT39 | 111-268 | None |
| A0A2S8BS66 | 13-216 | None |
| A0A1A0WDQ4 | 75-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.