DPCstruct | MC61460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 126 ± 2 aa |
| Standard deviation of domain lengths | 2.16 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 76.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D8YBA1 | 38-160 | FWHRFATLATRMEQYIQGQSRDLVDRAYTKFVTVMFATLDKIAQSDPKYADILLLENYAAFQNSLYDLANVVPTLAKFYHQASEAYE… |
| A0A6A2XH39 | 354-481 | VGVLSYIPRFATLATRMEQYIQGQSRDLVDQAYTKFVSVLFATLEKLAQTDPKYADIFVLENYAAFQNSLYDLANVVPTLAKFYHQA… |
| A0A453HFF9 | 90-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.