DPCstruct | MC6146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 308 ± 42 aa |
| Standard deviation of domain lengths | 42.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 49.55 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF17137- CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453QV83 | 3-293 | SFGSTLPDKGAHECAHKLPNGIWLPFDFGDSHPDLPVLYLRGGAILPVGLPIQHVGEASLGDDLSLLVALDENGKAEGVLFEDAGDG… |
| A0A072UDG9 | 304-639 | TFFADPTDPSLRKLENSFLLGPVLVYASTTRNQGLDKLEVTLPKGIWLGFDFGDAHPDLPALYLKGGSIIPAGLPLQHVGEANPSDE… |
| A0A2U1LYU7 | 122-426 | None |
| A0A2I0WHR0 | 3-247 | None |
| A0A0S7ZDL6 | 11-351 | None |
| A0A6D2ISX2 | 317-578 | None |
| A0A2R6VYJ1 | 126-422 | None |
| A0A0V0IXK5 | 192-534 | None |
| A0A835Q624 | 354-737 | None |
| A0A6A2ZU72 | 10-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.