DPCstruct | MC61453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512CEJ2 | 11-144 | TLPQDFADMLGWKELAQKVDAIYRDLELKDPNQTLVLCDNYGQAGAINYYSNASIKAVSFHADYINWFVFDHQYKHLIRVLYFDENN… |
| A0A2W7RLB5 | 47-176 | LPQDYADMLGWKELAEKVDLAYYKAPPDEYTIIICDNYGQAGAINFYTKTKGLRAVTMNADYVNWIDLSREIKNVILVREVEDGVSE… |
| A0A7C1JHQ2 | 2-127 | None |
| A0A7V9HYW4 | 152-293 | None |
| A0A7W1Q4V3 | 93-230 | None |
| A0A1A8Z599 | 81-211 | None |
| A0A1I6ZSK9 | 21-161 | None |
| A0A0M8XWF8 | 6-100 | None |
| A0A359CA33 | 18-166 | None |
| K1XZC4 | 13-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.