DPCstruct | MC61452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 12.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060C6D7 | 1-79 | MTFATHLFNAMPYITGREPGLTGAIFDEPDVYCGIIADGLHVDYANIRLAKRLKGDKLCLVTDATAPAGANIEQFIFCR |
| T0PHW7 | 11-113 | MGHSNATFEEAMESIKMGISHSTHVFNAMTPLNHREPGVVGAVFKSNITCELIADTVHVHPGIYEVLNKVKGTDKLVLITDSMRAGC… |
| A0A2H6EN78 | 2-101 | None |
| A0A0J9E8X4 | 3-87 | None |
| W4TXL3 | 35-113 | None |
| A0A7R8D5C1 | 119-213 | None |
| A0A7T4MDA9 | 1-83 | None |
| A0A4Y8X4U7 | 174-274 | None |
| A0A650LPM6 | 2-93 | None |
| A0A0M8U074 | 164-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.