DPCstruct | MC6144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453QRA0 | 1-50 | MEQFQDGHHVRLRSREHGMYLHADKDGRGVSLRRPRASMNAAWAVHLFQG |
| A0A453QR12 | 1-62 | MEQFHHGQHVRLRSRVHATYLHADEDGHGVSLHHRRASMNAAWAVHLHQFQNAQYLLLHSAA |
| R7WER5 | 1-66 | None |
| A0A4U6UW88 | 20-88 | None |
| A0A1E5W640 | 1-69 | None |
| A0A835FA13 | 63-129 | None |
| A0A2S3I4S2 | 1-72 | None |
| A0A835EKE6 | 1-70 | None |
| A0A6G1DFT6 | 1-75 | None |
| A0A3B6SDP4 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.