DPCstruct | MC61437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328TRA9 | 1-77 | MDAKKYGVLDRDGWREDIRKGFSEAFRVLRPQGTLVFKWNETQIPVRRVIELTDQKPTIWQRTGKGDKTHWILFLKS |
| A0A0H2UUM7 | 49-116 | YGQLDKENWKEDISKGFEECMRVLKVGGTLVFKWSDCQVNVREVLSAIPFKPLFGQQRGTTHWMTFVK |
| A0A2A2BN05 | 2-59 | None |
| A0A2E9LA15 | 170-246 | None |
| A0A0F9IAF1 | 86-179 | None |
| A0A0F9HSW9 | 30-108 | None |
| A0A0A2V5I7 | 604-677 | None |
| A0A663BKT4 | 18-91 | None |
| G6XIT4 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.