DPCstruct | MC6143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.95 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0028- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8IV36 | 28-84 | LDFMQELRKTVKVGIVGGSDLHKIAEQLGDGLLTQYDYVFAENGLVAHKEGKELAVQ |
| A0A830BII9 | 8-63 | MLEFMQELKKVVTVGVVGGSDLVKISEQLGITVFNDYDYVFAEKVLVAYKGGNLIG |
| A0A835NKZ0 | 19-72 | None |
| A0A1S3WN04 | 1-56 | None |
| A0A0D9WBB6 | 140-193 | None |
| A0A8A8CXP1 | 1-67 | None |
| K1R8K0 | 311-364 | None |
| A0A2J8AFQ7 | 28-84 | None |
| A0A7R9EH43 | 42-90 | None |
| A0A5N5K6J0 | 357-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.