DPCstruct | MC6142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 100 ± 25 aa |
| Standard deviation of domain lengths | 25.34 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0GLE4 | 3-80 | LSREHREHIRFCNVKRKKDFIYLERVNGKIVNILDGLELHTDVFSMAEQNRIVKFVEKLEEMGKSGQLKERTYTAPQK |
| A0A453QK88 | 12-113 | RPRARLTREQRELHRFRNVLRKDDFICLERVKGQLVNILAGLELHAGVFSTAEQKRIVDCVYGLQEMGKRGELGDRTYTEPEKWMRG… |
| A0A816Q2F5 | 42-132 | None |
| A0A4P1RNN5 | 9-123 | None |
| A0A445AA47 | 2-131 | None |
| Q5VPG6 | 167-237 | None |
| A0A7C9EAK7 | 139-223 | None |
| A0A287RD44 | 1-98 | None |
| A0A1P8B671 | 167-280 | None |
| A0A3P6FLK1 | 124-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.