DPCstruct | MC61418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1W5B0 | 1-87 | MIKDVLKALRDPNNNKVAICGMGGIGKTEMAIEIQRRAKADNLFDKVAMAMVSREPELKRIQADIAEKLGPRLNAEGLPGRSRPTAF |
| A0A4Y1QXD9 | 1-79 | MNDVLSALRNEKTRIIGICGMGGVGKTTMVREIIKRLEGTNKLFDDVVMSTVSATVSIRKIQTEIAESLDMKLVEESES |
| A0A2N9HN50 | 156-221 | None |
| A0A5N5KFW1 | 641-715 | None |
| A0A2N9I9Y0 | 153-218 | None |
| A0A6A6KU02 | 220-285 | None |
| A0A5J4ZE76 | 162-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.