DPCstruct | MC61414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218X6T2 | 126-199 | LCVLYMCMVYGLFVPDWEYEVLNGNFSVYKSSTQIVNCKVRGSLEPPCNAVGLIDRYLLGQNHLYQRPVYRRTK |
| A0A1R3H0P0 | 206-278 | LLSFYMCLLYGLYVPNWEFQAPSLNLFTNGSQTQIVQCGVRGSLEPACNAVGYVDRYFLGEQHLYQRPVYRRT |
| A0A1E5VIT1 | 137-218 | None |
| A0A830CK83 | 102-197 | None |
| A0A2N9GUS7 | 442-513 | None |
| A0A1J6IBZ2 | 61-135 | None |
| A0A446INS7 | 101-178 | None |
| A0A835PN78 | 24-97 | None |
| A0A2P2L294 | 2-68 | None |
| A0A067DMW0 | 95-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.