DPCstruct | MC61411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1VDV4 | 30-184 | QARGNFGLGAKMALIWSKMSTGLPIEISSSMKGQNYTSFCRLDIDIHRKNVTIRFARRTDVMPPVPVETKHHPSSVDLLLIKRLIGE… |
| A0A453KJV1 | 157-287 | ILHYMRQMAVITPYAQFLFRFLSDAAEKNLTIKFTRRTDVMPPVPLLTKHHPSAVDLLLIKRLITDTTKPNLLQFLQHEFVNISKAH… |
| A0A2R6ARW8 | 5-155 | None |
| A0A2J6MD29 | 74-213 | None |
| A0A2J6MD16 | 1-112 | None |
| A0A453KJF7 | 95-237 | None |
| A0A453KJN1 | 1-127 | None |
| A0A484IDE8 | 275-406 | None |
| A0A800BYI7 | 3-140 | None |
| A0A397F8V1 | 101-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.