DPCstruct | MC6141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661FEE9 | 13-72 | KHGSHTIRLIEDRLPTLLGVLGNKQLSSVELQFVDWGYNTEQDRTDARTKGIKVIGLSEF |
| A0A453QIZ9 | 3-67 | QHQGLTLHFVEDRLATLKNVIKEPALDKWNLYLVKWGYNTQEEREEAGAISRIQLIDLPDFSKQL |
| A0A6V7PY31 | 423-490 | None |
| A0A1E5VQV6 | 228-294 | None |
| A0A0E0AIU0 | 7-76 | None |
| A0A7S0HJE0 | 69-142 | None |
| A0A2P5XC10 | 229-296 | None |
| A0A7J7IM67 | 152-215 | None |
| A0A6A2YRK7 | 201-268 | None |
| A0A445DD27 | 226-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.