DPCstruct | MC61408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482Z4N6 | 76-185 | IAEAQKNDKTSMFDLVVADEAHRCTGQTGSAFTMVLDQSLIKAKKRLFTTATPKIYSTNLKKKASEMGVEITGMDDESVFGKVFHTL… |
| A0A0T1U5R7 | 2-96 | SGFDLAIVDEAHGTAGDLGRPWAAIHDNQRIPSDFRLYLTVTLRILAAARPQKGADGQEAEIATMADDPEGAYGAWLAELGLSEAIE… |
| A0A1V9K2K3 | 1-89 | None |
| A0A450SMG8 | 122-240 | None |
| K2KJF5 | 111-221 | None |
| A0A3L7NB66 | 292-406 | None |
| A0A1Q4Y9D1 | 1-95 | None |
| A0A3D9JKD7 | 2-104 | None |
| A0A6B1LA31 | 167-271 | None |
| A0A1B9ET83 | 143-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.