DPCstruct | MC61406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1PYW1 | 2-74 | FHHLQNGADEKKIAWLLKHAYHMSEQDIETYIKRFFGRFYSQQFKRQTLPEGPKILGISLSPRGQYRMPSDVK |
| A0A7X8E1C2 | 133-207 | YYFLKYNFKPRKILFMAEQAFRDKYDQKTILHWLKLFIRRFFNNQFKRSAMPDGPSVLDITLSPRKGLSMPSDAI |
| A0A7Y5BKF1 | 42-116 | None |
| R6RAA1 | 1-84 | None |
| A0A645J490 | 17-90 | None |
| A0A644ZWM9 | 74-147 | None |
| A0A1Q6PIU6 | 2-61 | None |
| A0A348WT68 | 712-799 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.