DPCstruct | MC61401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q00247 | 1-111 | MNIDQLRRSLKDRWLDYYEANRSWISRLSIWVSCEGKRRPSSSFILGVLSTEEPRLTEMLPLIVDLSNHPDRIVVALGLNFDPEQEL… |
| A0A2L2XND4 | 184-292 | FEELLKILPDKWLDYYQNNQPWIKSLMDSKDSWRKTPDGGKRASADIIIGAITVLESQLSVWMYPFCQLSSDGNKLLEVLGLNFDPE… |
| A0A2A2TKD4 | 1-137 | None |
| A0A1U7I3Q5 | 4-136 | None |
| A0A433W291 | 4-149 | None |
| A0A0D6AE58 | 1-140 | None |
| Q115L2 | 1-109 | None |
| A0A2T1CA38 | 8-121 | None |
| A0A2I8A305 | 1-140 | None |
| A0A3D1PDZ8 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.