DPCstruct | MC614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 152 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05823 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q19477 | 28-171 | GFQKFKNLLPRELVEAYSNLSQKDQPDLKDVFRNHQNYRNEQEMVNALKMKNPALGARMERRLMALKQKIDGLSSEEAKGFIQNLIS… |
| A0A0N4WNB1 | 1-131 | MPKEAKNYLNSLSKTDKAAIMEIAKNFAKYRSEEEALAALKAKAPELGDRIEKYRQNIQTRIGALGPEAKKYANDLVAMARKIHVSI… |
| A0A3P7IV33 | 23-172 | None |
| A0A0B2UVQ3 | 162-322 | None |
| A0A183FRK5 | 117-246 | None |
| A0A0B1TT10 | 6-171 | None |
| A0A0M3IFG1 | 7-187 | None |
| A0A4U5MD63 | 1-170 | None |
| A0A368FXZ5 | 57-211 | None |
| A0A0M3HX24 | 62-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.