DPCstruct | MC61399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 262 |
|---|---|
| Mean domain length (aa) | 163 ± 34 aa |
| Standard deviation of domain lengths | 33.71 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.76 |
| Pfam Score | 86.13 |
| Assigned Pfam label(s) | CL0023- PF00330- PF04412- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3FJJ0 | 228-402 | NCVYDRVIHIDLDKLEPHVNGPYTPDLGHPISKLKEQALAAGWPMEISVGLIGSCTNSSYEDMSRAASIARQAINHGVKAKSKFTIT… |
| A0A7V6W689 | 40-186 | KPQIACPFSPVNVKPVAEVAGTPITQVAVGSCTNGRLNDIEQVYNVLKDRKVASHVNMLVFPASRDIQNEMDRRGWSEVIRNAGATI… |
| A0A1F4V3C9 | 48-203 | None |
| A0A7M3RRE8 | 464-612 | None |
| S9R6D7 | 10-182 | None |
| A0A1M7PF56 | 233-407 | None |
| A0A7C7PDK4 | 230-387 | None |
| A0A2T6ZP41 | 247-392 | None |
| A0A447QV26 | 162-377 | None |
| A0A3Q0JB04 | 472-642 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.