DPCstruct | MC61388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30643 |
|---|---|
| Mean domain length (aa) | 210 ± 38 aa |
| Standard deviation of domain lengths | 38.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.33 |
| Mean intra-cluster sequence similarity (%) | 10.78 |
| Pfam Score | 68.14 |
| Assigned Pfam label(s) | PF20912- PF11797- PF21307- PF18701- PF20419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090WB64 | 140-347 | RPEPQVHIVGHWNYTPETKKTIYVISNCASVKLYVNDKLIGTNNAPENGYVFKFDQVAWETGEIKAEAFIDSELKTTQTKETAGEPE… |
| A0A2E7USY0 | 22-227 | SCEGAGGLKVLENPPGVAIIDPADGSEFSEGESIPFVGRIDSSFTGGDIEVSWSSDIDGEFEDPDPPDPEGYVEFVTASLSTGTHIM… |
| A0A7C6K248 | 239-482 | None |
| A0A852V435 | 212-410 | None |
| A0A7S2SFR0 | 367-553 | None |
| V9W3W1 | 117-356 | None |
| A0A2N2WME8 | 104-313 | None |
| A0A2N2WKV0 | 151-283 | None |
| A0A2N2WAT1 | 347-522 | None |
| A0A168SE14 | 294-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.