DPCstruct | MC61387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7UPG5 | 1-125 | MSPNSPRKPTVSNTPNPKDTPEEHRARMVKAKAAQDAEVASKKIRRGVVVVHTGNGKGKSTAGFGVVLRAAGHGQKVAIVQFIKGTW… |
| S3JED9 | 1-121 | MQLTPKQYKEKMQRRKAIQEERLAEKIAEKGLIIVNTGDGKGKTTAALGMVLRSLGHGYKVAVVQFIKGAWEPAEQKIFSVWGEQIE… |
| A0A5E6NTV5 | 155-262 | None |
| A0A496WST4 | 2-119 | None |
| A0A653A490 | 7-99 | None |
| C1DPP7 | 808-932 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.