DPCstruct | MC61383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 176 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1P4F3 | 633-813 | VHAGPFANIAHGNSSVLADKIALKLVGKEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLK… |
| A0A2X1WLX8 | 95-276 | TPAFIHGGPFANIAHGCNSILATKLALATSDYAVTEAGFGADLGAEKFMDIKCRKAGLAPDAVVIVATIRALKMHGGVDKKELKAEN… |
| A0A553MV03 | 620-794 | None |
| A0A3D4ZYS0 | 264-437 | None |
| A0A812LKM4 | 148-318 | None |
| A0A7J6SQD3 | 33-228 | None |
| A0A653DCT0 | 33-205 | None |
| A0A402FFY9 | 252-411 | None |
| A0A665W8F4 | 514-694 | None |
| A0A7C7W6G1 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.