DPCstruct | MC61382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 213 ± 34 aa |
| Standard deviation of domain lengths | 33.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1P2J7 | 29-233 | MPPIPRHETWVVGWIQACNQMEFFNTYSDLGMSSWELPDLREGRVKAISDSDGVSYPWYGNTTETVTLVGPTNKMSRFSVSMNDNFY… |
| A0A060WHG1 | 30-245 | NPTSIDESSNVVLRYRTPHFRASARVLVPQVAGKETWTVGWIQACNHMEFYNKYGTKGMSSWELPDLRDGKIQAISDSDGVNYPWYG… |
| D5SZ87 | 638-835 | None |
| A0A654GX89 | 291-534 | None |
| A0A1I8I9J9 | 474-679 | None |
| A0A7X9KD43 | 223-415 | None |
| A0A3D4PNK7 | 377-559 | None |
| A0A523CJ66 | 1-171 | None |
| A0A1V3PXN6 | 62-303 | None |
| A0A4S2L769 | 22-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.