DPCstruct | MC61367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061RXP7 | 9-120 | QPLAGARTLPPLCDPTVESVADLKQPGEHICTRFCQISHLFGNAYRCETTGAVHICDINCNQKIFYDNHSQICRLSRRIFSNQEILM… |
| A0A7G2EV65 | 12-94 | GSANVIYLSAILGHEGPNHKCDWKCENENVCGNMYRCKLTGLTHVCDKNCNQRILYDNHNSLCRASGRIFPLSLVEEQAVKGV |
| A0A835XT90 | 1-97 | None |
| A0A4Y7KNZ2 | 10-145 | None |
| A0A446IWJ0 | 42-185 | None |
| A0A444WV55 | 100-213 | None |
| A0A5B8MNS4 | 12-129 | None |
| A0A7J7MPZ2 | 34-162 | None |
| A0A7J7Q8U6 | 5-110 | None |
| A0A6N2MBX8 | 13-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.