DPCstruct | MC61363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 116 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6ZGD6 | 412-548 | YKIYLCPLTVLSLDNHNRIRTTDNRLLRRIVRDNRTRGYSASDTLSSWGKVREGEEKYVFPFQDEADVIFNTSLIYELGVLKTYAEP… |
| A0A3B0V9W1 | 7-108 | DSRYRGYSALETLQRWPSVRRGEEKHIFPYQEEADVMFNTALLFELGVLKRLAEPLLREVPPNTPEYSEAKRLLKFLSYLVCINEKE… |
| A0A1V5YSU0 | 17-119 | None |
| W4P7H0 | 2-87 | None |
| B6DTC6 | 392-524 | None |
| A0A7Y5F181 | 281-392 | None |
| A2G0E6 | 1-135 | None |
| A0A7C2WZQ3 | 3-142 | None |
| X6PED6 | 109-231 | None |
| A0A661Q3I5 | 188-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.