DPCstruct | MC61357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 6.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 38.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815V087 | 35-117 | LKNNGECSDNFNCRCSTVVPTGERICTLQVECSLATPCNSADKCDTTDSICVIDNRCNGQHLCYPVSLTSPDMCPPLATNDNI |
| A0A819N6Z6 | 12-105 | LSLTAAVNCQTCHNVTQYGPCSVNTACGCLYLSSAVNTGICGLLSLTCSSLVECDTRNSACYEPGHICLNHPRCSNKPLCYPLAMTA… |
| A0A819QH33 | 20-111 | None |
| A0A815H818 | 289-386 | None |
| A0A815W9S1 | 48-117 | None |
| A0A822CZ15 | 6-90 | None |
| A0A820AMN8 | 57-139 | None |
| A0A818VUA9 | 26-102 | None |
| A0A818WHV9 | 6-92 | None |
| A0A819ULK7 | 29-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.