DPCstruct | MC6135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 187 ± 25 aa |
| Standard deviation of domain lengths | 25.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090SRE2 | 2-176 | AKEFLIELGTEELPPTQLRTLAEAFAANFEAELKGADLTHEGVKWYAAPRRLALKVAGLAESQADKVVEKRGPAVSVAFDADGNATK… |
| A0A453QAB9 | 119-330 | TFVLEIGTEELPPHDVVEATEQLEKSLVQILGKRRLSHGKVHSYGTPRRLAVVVENLSLKQMEEEVELRGPPVTKAFDQEGKPTKAA… |
| A0A816NH46 | 3-185 | None |
| A0A0B7MKG8 | 11-178 | None |
| M4YZG3 | 2-209 | None |
| A0A075ML48 | 3-136 | None |
| A0A3B6TB22 | 117-325 | None |
| A0A6I1JEH7 | 2-218 | None |
| G5GSB6 | 6-169 | None |
| A0A6I4IYG2 | 2-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.