DPCstruct | MC6134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 65.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7LZI4 | 1-48 | AGTAPADLTVAQLESLKEVCEANLACEHMMDVSGIIAAYTAYYGPIPY |
| Q804T8 | 6-59 | AAVLLRRRRAPGEPTPQQLESLREVCELNIACDEMADTAGIVAAYAAYYGPPPF |
| A0A6P7IZ66 | 206-269 | None |
| A0A3B5AXG8 | 151-214 | None |
| A0A1S3L5F0 | 92-154 | None |
| A0A674N633 | 195-255 | None |
| A0A553NMS0 | 90-151 | None |
| A0A2U9CPF8 | 20-81 | None |
| A0A0N8JW68 | 20-88 | None |
| A0A5A9NXR6 | 35-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.