DPCstruct | MC61338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 126 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.56 |
| Pfam Score | 73.77 |
| Assigned Pfam label(s) | CL0039- PF03485 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376U9F2 | 1-109 | MNIQALLSEKVRQAMIAAGAPADCEPQVRQSAKVQFGDYQANGMMAVAKKLGMAPRQLAEQVLTHLDLNGIASKVEIAGPGFINIFL… |
| A0A3B0S313 | 3-117 | ILEELSWRVGDAFAEAGLEPHLGRVKPADRPDLAQFQCNGALAAAKAAKQNPRALAEKVCETLRREAAFKDVSIAGPGFINLTLTDD… |
| A0A2N1TBK4 | 295-410 | None |
| A0A7S3UZQ0 | 254-387 | None |
| A0A376S9F0 | 6-132 | None |
| S0ET34 | 1-122 | None |
| A0A536IGV7 | 63-177 | None |
| A0A7V3EUR3 | 2-100 | None |
| A0A537J0Y9 | 1-138 | None |
| A0A2W6S2D3 | 5-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.