DPCstruct | MC61335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 238 ± 42 aa |
| Standard deviation of domain lengths | 42.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9N4M3 | 10-244 | PFVQNEMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDF… |
| A0A507DBW5 | 25-310 | GATPCAAEASVYALLDGIMQPCEAHIASLKTYTGCGDAIRKAISTPSKESEDAAWAAVAPAVSRLSTYYELSQLIEEAYPTLLAFFC… |
| A0A2I4AK58 | 6-197 | None |
| A0A5C6NH79 | 432-625 | None |
| A0A0R3QQ19 | 42-238 | None |
| A0A7R9P188 | 2-252 | None |
| A0A668RHN2 | 1-209 | None |
| K3W891 | 2-225 | None |
| A0A1I8FKE2 | 32-225 | None |
| A0A388L3X4 | 44-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.