DPCstruct | MC61331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 145 ± 30 aa |
| Standard deviation of domain lengths | 30.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.45 |
| Pfam Score | 80.85 |
| Assigned Pfam label(s) | CL0036- PF08502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645JHM0 | 2-116 | LPRLTELYETLSGSSVGPHKAVLGREVFTVGSGVHVDGILKNSANYEPYPPELVGARRRIVVGRHAGRVSVLHVLRQLGYQPDEAGA… |
| A0A507D0F5 | 724-857 | ADKDYVRAKYRLEKLREIENLVAEAVQVQVPFNNYITGYCAFTHKAGIHAKAILANPSTYEILNPEDFGMTRYVSIGHRLTGWNAVK… |
| A0A836DB31 | 4-128 | None |
| A0A5K1K0X7 | 36-182 | None |
| A0A2T0LSN2 | 715-843 | None |
| A0A379AKV9 | 2-108 | None |
| A0A7C6IQM5 | 15-153 | None |
| A0A3M7MDG0 | 304-431 | None |
| A0A3N7JBM5 | 3-102 | None |
| A0A7C4AHM4 | 7-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.