DPCstruct | MC61330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 57.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507CVL2 | 2-104 | PEEISTAERECTKSDQETWAVFLERFVRSYDIARAYYSTKKYKRKRWDADKANRGELDRVLEGIVNMVDESMGHKLSGGEKVIVAIG… |
| A0A507CU75 | 19-156 | EPERRFRNWLEADKPEAIYSAERECTKSDQETWAEFLERFVTSNDIARTYYSSKKYKRKRWDADKAKRGELDRVLEGIVNMVAESMG… |
| A0A197JHZ8 | 285-409 | None |
| A0A197JEW2 | 1-154 | None |
| A0A507DBC8 | 168-298 | None |
| A0A507D8H6 | 220-357 | None |
| A0A507D5R9 | 88-219 | None |
| A0A507BWB4 | 1-154 | None |
| A0A507CMQ9 | 26-165 | None |
| A0A507CGW4 | 387-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.