DPCstruct | MC61329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 147 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507CLZ7 | 178-330 | RLWSEHQTSLKGQKTKILRLLYSRNHRRLAVIMLPKRPISAKADLDDQPSKKARPAKKSSDKITPKANGGANLNKRITDVLEELGKK… |
| A0A812LCP4 | 1-127 | SVAAAPAAAPAQKKPDSPPPRKPEKRAAEQPKKQAAKSPKKTSGPNEELAKLFDELSSFEFKKGGTSKFAGVAYKSVAGTLRGLDEK… |
| A0A0P1B1H2 | 528-722 | None |
| A0A544ZXM6 | 355-541 | None |
| A0A7S1QWF7 | 1-119 | None |
| A0A6C0JDN1 | 15-187 | None |
| G4ZJ70 | 193-332 | None |
| A0A6P6V9D0 | 312-438 | None |
| A0A5D6XF45 | 118-236 | None |
| A0A3M6VLR5 | 82-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.