DPCstruct | MC61326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 452 ± 83 aa |
| Standard deviation of domain lengths | 82.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507C8H7 | 1-427 | MLTLYILISILLLQSSHSADTDPTVDQLNAWRDHIRGFRHNHVDLVERKLDVGLETRLFDAVDTVALITYAEYWVGQGFRLSIEGQD… |
| A0A507CRD3 | 1-320 | MTLTHFIITLLLWHHAVPTIAEITDEEYRSYAESLREYRYGMTDDMKEQLKYNLEHPYGVGITDLLIEAVIPEDLRKYMKVNVRDPH… |
| A0A507D9D7 | 5-436 | None |
| A0A507D988 | 1-461 | None |
| A0A507D904 | 312-765 | None |
| A0A507D4L1 | 4-447 | None |
| A0A507D2G7 | 414-960 | None |
| A0A507D0Q4 | 56-415 | None |
| A0A507CRD2 | 10-539 | None |
| A0A507CSN6 | 2-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.