DPCstruct | MC61325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 186 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507C1M0 | 1-183 | MDPSANLESAKEWDNAIKLKRKTLFGVSRDGKDGSLHARIMSLGNQKVAVGQLNSEVGTWANLSFELLYLTNDDDERYSIQAHEALF… |
| A0A834BG28 | 179-365 | DHFTSPDEYDDPTVLYEAIVSHEKNLVIAHEGDPAWRSAVLANSPSLLALRHVMDDGTNEYKIIMLNRRYLSFRVIKVNKECVRGLW… |
| A0A183VYJ9 | 53-233 | None |
| A0A819JL82 | 145-348 | None |
| A0A4D9EDT8 | 336-520 | None |
| A0A7J8BMJ7 | 180-358 | None |
| A0A3P8D173 | 178-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.