DPCstruct | MC61320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 271 ± 50 aa |
| Standard deviation of domain lengths | 49.71 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G8ARN2 | 1-319 | MNRLQRYLFRNLLIALLYSTAGLTLTIWLSQSLRLIEMVVEAGAPMRVFLWLLILTVPTFLGIVLPLALVGAVLFTYNRLATDSELV… |
| A0A3M1QUF9 | 123-408 | RTLAAWRQRPWTAPDLSAQIRAFSLRHQIYRLYRRIGVELQRGNALVLTDDHGRRYEFSALEISGQDRALRVADARLVRYDPDESAP… |
| A0A534MZP7 | 20-257 | None |
| A0A3N5Q9N7 | 168-482 | None |
| A0A523JVQ1 | 85-307 | None |
| A0A2H6HWC1 | 2-285 | None |
| A0A832AUG6 | 2-312 | None |
| R5BZT4 | 4-296 | None |
| A0A4Q3AIM1 | 3-285 | None |
| A0A534BTE3 | 4-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.