DPCstruct | MC61314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 205 ± 11 aa |
| Standard deviation of domain lengths | 10.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7PUL0 | 71-276 | KLLYQYEAMMQLKEQEKLSRHQAWESELEVLEILKLLEEEEEAHTLKISIYDTKRNEKSREYREAMERVMHEEHLRQVEAQLDYLAP… |
| A0A182RTG5 | 17-230 | SNPWDPQPTQLDLFLMLKEQLKAEELASHAFRRRVVEIDTMLSERRKQTDSPRLTNSLFDPLRNEEARQLRLAKYEAIKAREEQIKQ… |
| A0A7S0R7H1 | 1021-1223 | None |
| A0A6T8P641 | 368-575 | None |
| A0A4C1TV38 | 99-308 | None |
| H2YT26 | 248-423 | None |
| A0A5A8CLH0 | 991-1202 | None |
| Q4D3F1 | 756-977 | None |
| E4X0V4 | 779-985 | None |
| A0A7R9IET1 | 36-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.