DPCstruct | MC6131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 298 ± 30 aa |
| Standard deviation of domain lengths | 30.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0363 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257RZB9 | 1-296 | MNRGDRLITRSGAMRAVRWVGRRSLDAGDHTHPQSVWPVRIDRGAFADGLPERSLWLSPDHAIYLDGCLVPAKALVNGRSITQEPRR… |
| A0A6P1C9U5 | 77-375 | LRVGDVAITASSQHRPIRWIGSTELDCTNVIDPRACWPIRIAAGALGANKPSQDLLVSPAHGICTAVVTDILIPASALVNGATIDHL… |
| A0A0Q6CVC7 | 238-569 | None |
| A0A844HQI1 | 152-457 | None |
| A0A6N3TAG4 | 384-698 | None |
| A0A511BQQ4 | 705-1047 | None |
| G6F2Y2 | 1-250 | None |
| A0A1M3Q885 | 379-673 | None |
| A0A257PHG2 | 529-806 | None |
| A0A1Y3G1C5 | 421-734 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.