DPCstruct | MC61309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 192 ± 17 aa |
| Standard deviation of domain lengths | 17.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182XYI0 | 227-418 | ESCPIYLTISANGRSVEDAPLVINWGPGCANPPAWIGLYTENPALSNASPIAQVFPNGQHSGAVASEVKFGRRKLPGGWSHEQVLQH… |
| A0A3S3PC49 | 6-188 | HQKMKFIYIDSAEVWITISSNLKKVNGKTVDRLLVLNWRNVDISGLDRIGLYNNEIGNNIEVSKAIVSIKPTAKEGSFRTEQNFPLH… |
| A0A834KF44 | 1-213 | None |
| A0A146LAC2 | 1-215 | None |
| A0A1J1J8X5 | 354-530 | None |
| A0A2J7Q8Y6 | 1-184 | None |
| A0A6A4VSH3 | 13-175 | None |
| T1GBM9 | 5-165 | None |
| A0A7R9NYW2 | 121-326 | None |
| A0A482WSQ9 | 22-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.