DPCstruct | MC61303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 15.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | CL0475- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A131ZUG4 | 13-113 | LTYNQLSDLYDHAEHIKPSLTQINLESCCDIPEDLSKFAKTNSITVLTHNDTSEILQMDKIQNFSFERSFKSHPKWLARYTFVLSDR… |
| A0A3N4JAI2 | 181-285 | RIGLAEFGTTRLSQLLPQTNVKPSVDQINVRDCCVVPKPLILYAKERGIELLTHNDCTDILPVETLRQLVVDEFGLFRTDTKLVPQW… |
| A0A310S775 | 112-213 | None |
| A0A0S7FLM8 | 50-160 | None |
| A0A151GV93 | 366-510 | None |
| A0A6V7H4H0 | 87-185 | None |
| T1FZ88 | 69-171 | None |
| A0A395IXE7 | 17-165 | None |
| H0Z635 | 333-439 | None |
| A0A0S7DFT9 | 458-580 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.