DPCstruct | MC61302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 9.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A131ZU16 | 1-92 | MPQAKITQLTDWNRFGTKFSHTYFLEPENSEFIQVGSVFLDEYRKVYGTDHFYNIDLFNEETPSSSQIDYLRQCGKNVYKAIQSIDS… |
| A0A1Y1NFQ6 | 238-347 | IVPVLPAFAGHVPRAIQRLFPNSKVTKTEQWNKFNDTYCCPYLLEPTDPLFQTIANMFMDELIQEFGTNHVYSCDTFNEMLPDNRDV… |
| A0A0C9VTQ1 | 154-261 | None |
| X6MBK3 | 5-92 | None |
| A0A7J6FA75 | 288-397 | None |
| A0A2G5CG43 | 78-194 | None |
| A0A1B0DPA5 | 247-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.