DPCstruct | MC6130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 123 ± 29 aa |
| Standard deviation of domain lengths | 29.33 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804NPL1 | 58-187 | QAVVRDLRQLAAKYASNRKDGSKLQALCNAAKNCASLPHDELNRKIHLVAVPGHSVFVAKHEDKRALRNIFILLFRHKEPNGTLTKQ… |
| A0A0A9GGL1 | 17-112 | SDRKDGPKLQALSNAAKSCASLPHKELEESICQVAVPVHGVYVAKPTLQKNLRNILILLFRAKESNATLTKQEILDAAADRLKREIT… |
| A0A023B1J0 | 641-740 | None |
| A0A2J7ZW00 | 638-796 | None |
| L1ILE5 | 267-407 | None |
| A0A834ZBY8 | 708-824 | None |
| A0A540M1N7 | 258-376 | None |
| A0A392PKN9 | 3-92 | None |
| A0A835PGQ1 | 7-105 | None |
| A0A5J5ANM9 | 222-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.