DPCstruct | MC613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 146 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535W9P7 | 2-125 | DFNIITGPTVRPVNAAYAYSSCNGCQTLAVALQINLISMTATDIRPVNLSKAINYSCHDCLTVADAVQYTIAVADPERVEPRVEELF… |
| A0A536PP18 | 30-173 | SAAVAINTTDGKTVWRIQFHVVRDRTTIVNNANIAFAYSSCTGCQTYAISFQTVLDFNNATVVTPTNQAWAINYLCTSCVSYADATQ… |
| A0A7V9FJL9 | 31-195 | None |
| A0A535ITD4 | 70-225 | None |
| F6FPP6 | 146-319 | None |
| A0A6I7YU74 | 21-160 | None |
| A0A2J8GGF6 | 611-761 | None |
| A0A1Q7UHC9 | 22-179 | None |
| A0A536K3T4 | 3-114 | None |
| A0A538FFW8 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.