DPCstruct | MC6129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 103 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 65.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6K5T7 | 245-355 | LEVEPKLAVPMGPAITVSVLANRKDSNKMACIINKSTFDYIDSNAARALAYEYLRFSPRHPFTSDIRAWMSLLFLCKGANTIEVFGI… |
| A0A0A9GF45 | 1-112 | MMEVEPKLTIPMGPSITVSVLAHRKDTNKMACIINKSTFDYIDSNAARALAYEYLRFSPRHPFISDIRAWMSLLFLYKGANMIEVFG… |
| A0A6A4PU94 | 1-94 | None |
| A0A5J5C1V4 | 103-215 | None |
| A0A3L6TEG7 | 440-549 | None |
| A0A835R811 | 91-202 | None |
| A0A5N6L753 | 76-156 | None |
| A0A0D9Z922 | 50-160 | None |
| A0A0D9Z7C2 | 1-72 | None |
| A0A068U198 | 247-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.