DPCstruct | MC61287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 268 ± 47 aa |
| Standard deviation of domain lengths | 46.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5C899 | 1-267 | MKAGCITLVLILSVILYHGYSLKTPFHPKDLLPLLPRKISWPILNSLNSPINLLPTFVGSASFVNTSLGWKGACFYNTSAWMEFHNN… |
| C5KTY2 | 3-194 | YNFLPRHVATLDNDGQWHSFSGRCFRSIKVRSTEQHDGTIVIEADYQDAVSWTCAEYVLYGNVEDFSVRYEEMHGTKIYTWTANKGK… |
| A0A2U1N000 | 1-281 | None |
| A0A813A273 | 374-703 | None |
| A0A6N2NHK4 | 10-281 | None |
| A0A7I8IK22 | 1-290 | None |
| A0A6N2MPG8 | 433-697 | None |
| A0A834FT80 | 236-444 | None |
| A0A0E0ERV6 | 7-359 | None |
| A0A1R3GA43 | 398-612 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.